PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013625903.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 377aa    MW: 42216.9 Da    PI: 5.3324
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013625903.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding507e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rgrWT+eEd++l  +++  G g+W++ ++  g++R++k+c++rw +yl
   XP_013625903.1 14 RGRWTAEEDQILSSYIQSNGEGSWRSLPKNAGLRRCGKSCRLRWINYL 61
                     8*********************************************97 PP

2Myb_DNA-binding55.51.3e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ T+eE++l v+++  lG++ W++Ia++++ gRt++++k++w+++l
   XP_013625903.1  67 RGNITPEEEDLVVKLHSTLGNR-WSLIASHLP-GRTDNEIKNYWNSHL 112
                      7999******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.2E-22564IPR009057Homeodomain-like
PROSITE profilePS5129417.277961IPR017930Myb domain
SuperFamilySSF466891.98E-2811108IPR009057Homeodomain-like
SMARTSM007171.9E-111363IPR001005SANT/Myb domain
PfamPF002493.7E-141461IPR001005SANT/Myb domain
CDDcd001672.60E-81661No hitNo description
PROSITE profilePS5129426.49362116IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.6E-2665116IPR009057Homeodomain-like
SMARTSM007171.4E-1766114IPR001005SANT/Myb domain
PfamPF002498.0E-1667112IPR001005SANT/Myb domain
CDDcd001676.28E-1271112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009813Biological Processflavonoid biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 377 aa     Download sequence    Send to blast
MGRAPCCEKV GIKRGRWTAE EDQILSSYIQ SNGEGSWRSL PKNAGLRRCG KSCRLRWINY  60
LRSDLKRGNI TPEEEDLVVK LHSTLGNRWS LIASHLPGRT DNEIKNYWNS HLRRKLHNFI  120
IRKPSISHNV LAVVINAPPR SPRPPTKRRP GRTSRSTMKP KTHHPKIRKM KKTSEPPEPE  180
ASVAVKAGEE TLMMELNEAE AELGPCNYYV TCHEGGACRN NDNNNSSIDC DKGVSSFDED  240
IVDLLLDESA PSHVFTSCGG NAELNHLGDS GQAKRSSEIL NQESLDCLQS CPSMESFLNY  300
EHQVNNAFTG EFIDWDDCVW QQGNDNNICD EKEGSDSIVS WLLDGEDEAT IGESNCENSG  360
EPLDHDEENA LVAWLLS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-231211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC9667440.0KC966744.1 Brassica napus MYB transcription factor 12 (MYB12.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013625903.10.0PREDICTED: transcription factor MYB12-like
SwissprotO222641e-175MYB12_ARATH; Transcription factor MYB12
TrEMBLA0A0D3B7450.0A0A0D3B745_BRAOL; Uncharacterized protein
STRINGBra000453.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47460.11e-159myb domain protein 12